Unscramble RIDES

The letters R, I, D, E, S can be unscrambled into 36 words, including 3 anagrams that use every letter: DRIES, SIRED and RESID. The highest-scoring common word is DRIES (6 points).

R1I1D2E1S1
Meaning

What does RIDES mean?

RIDES is the plural of RIDE, which means:

  1. noun a journey in a vehicle (usually an automobile)
  2. noun a mechanical device that you ride for amusement or excitement
  3. verb sit and travel on the back of animal, usually while controlling its motions
  4. verb be carried or travel on or in a vehicle

Definitions from WordNet 3.1, Princeton University.

Word facts

RIDES in word games

6classic points
6Words With Friends points
5letters (2 vowels)
Fairly commonabout 11 uses per million words

RIDES is valid in the ENABLE word list used by many word game apps. In everyday English it is fairly common: seen regularly in books, news and online. Points are face values only, without board bonuses.

Anagrams of RIDES

Words that use all 5 letters exactly once.

dries6sired6resid6

Words made from the letters in RIDES

36 words, longest first. Faded words are valid in word games but rarely used in everyday English.

Points

5-letter words 3 words

dries6resid6sired6

4-letter words 12 words

dies5dire5ides5ired5reds5ride5rids5side5ires4reis4rise4sire4

3-letter words 13 words

die4dis4ids4red4rid4ers3ire3rei3res3sei3ser3sir3sri3

2-letter words 8 words

de3ed3id3er2es2is2re2si2

Add one letter to RIDES

Words you can make with all the letters of RIDES plus one more. Handy when there is a free tile on the board.

raised7desire7drives10spider9riders7debris9reside7divers10stride7brides9risked11ridges8slider7diners7prides9driest7rinsed7snider7dermis9ciders9dimers9idlers7prised9weirds10

Unscramble your own letters

Change the letters below, add blanks with ?, and see every word instantly.

Up to 15 letters · use ? or * for a blank tile

0 words found
Show
Points

Type some letters above and the words appear here instantly.

More words to unscramble

REWARDSRHYTHMRICERICHRICKRIDERIDGERIDINGRIFLERIGHTRIGHTSRING

All words starting with R →   Word list: starts with R →

Frequently asked questions

What words can you make with the letters in RIDES?
You can make 36 words from the letters R, I, D, E, S. The longest common ones are DRIES, DIES, DIRE, REDS and RIDE. The full list, grouped by length, is shown above.
What is an anagram of RIDES?
RIDES has 3 anagrams in our word list: DRIES, SIRED and RESID.
How many points is RIDES worth?
RIDES is worth 6 points with classic tile values and 6 points in Words With Friends, before any board bonuses.
Is RIDES a valid word?
Yes. RIDES is in the ENABLE word list used by many word game apps, and it is a noun in the WordNet dictionary.

Scrabble® is a trademark of Hasbro, Inc. in the USA and Canada and of Mattel, Inc. elsewhere. Words With Friends® is a trademark of Zynga Inc. Wordle® is a trademark of The New York Times Company. WordUnscramblerPro is an independent site and is not affiliated with, sponsored or endorsed by any of them. Word validity follows the public-domain ENABLE word list, which is close to, but not the same as, the official tournament dictionaries.